HPA003548

SEPT3 antibody from Sigma-Aldrich
SEP3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003548
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003548, RRID:AB_1079908
Product name
Anti-Sept3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003548
Antibody type
Polyclonal
Antigen
Neuronal-specific septin-3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LSKVVNIIPVIAKADTMTLEEKSEFKQRVRKELEV
NGIEFYPQKEFDEDLEDKTENDKIRQESMPFAVVG
SDKEYQVNGKRVLGRKTPWGIIEVENLNHCEFALL
RDFVIRTHLQDLKEVTHNIHYETYRAKRLNDNGG
Storage
-20C
Provider Type Product Number
- No reagents -