HPA018481

SEPT2 antibody from Sigma-Aldrich
DIFF6, hNedd5, KIAA0158, NEDD5, Pnutl3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018481
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018481, RRID:AB_1856684
Product name
Anti-SEPT2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018481
Antibody type
Polyclonal
Antigen
Septin-2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
WGVVEVENPEHNDFLKLRTMLITHMQDLQEVTQDL
HYENFRSERLKRGGRKVENEDMNKDQILLEKEAEL
RRMQEMIARMQAQMQMQMQGGDGDGGALGH
Storage
-20C
Provider Type Product Number
- No reagents -