Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502363 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Membrane-Associated Ring Finger (C3HC4) 2, E3 Ubiquitin Protein Ligase (MARCH2) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-MARCH2 antibody: synthetic peptide directed towards the C terminal of human MARCH2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Canine
- Host
- Rabbit
- Antigen sequence
TIALFTIYVLWTLVSFRYHCQLYSEWRKTNQKVRL
KIREA DSPEGPQHSP- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Long-term results of saphenous vein graft for coronary stenosis caused by Kawasaki disease.
DLG1 is an anchor for the E3 ligase MARCH2 at sites of cell-cell contact.
Wakisaka Y, Tsuda E, Yamada O, Yagihara T, Kitamura S
Circulation journal : official journal of the Japanese Circulation Society 2009 Jan;73(1):73-7
Circulation journal : official journal of the Japanese Circulation Society 2009 Jan;73(1):73-7
DLG1 is an anchor for the E3 ligase MARCH2 at sites of cell-cell contact.
Cao Z, Huett A, Kuballa P, Giallourakis C, Xavier RJ
Cellular signalling 2008 Jan;20(1):73-82
Cellular signalling 2008 Jan;20(1):73-82
No comments: Submit comment
No validations: Submit validation data