HPA002480

DFNB31 antibody from Sigma-Aldrich
CIP98, PDZD7B, USH2D, WHRN
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002480
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002480, RRID:AB_10601995
Product name
Anti-DFNB31 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002480
Antibody type
Polyclonal
Antigen
deafness, autosomal recessive 31 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VDPGSEAEGSGLKVGDQILEVNGRSFLNILHDEAV
RLLKSSRHLILTVKDVGRLPHARTTVDETKWIASS
RIRETMANSAGFLGDLTTEGINKPGFYKGPAGSQV
TLSSLGNQTRVLLEEQARHLLNEQEH
Storage
-20C
Provider Type Product Number
- No reagents -