HPA014585

TMEM261 antibody from Sigma-Aldrich
C9orf123, MGC4730
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014585
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014585, RRID:AB_1845803
Product name
Anti-C9orf123 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014585
Antibody type
Polyclonal
Antigen
Uncharacterized protein C9orf123
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MGSRLSQPFESYITAPPGTAAAPAKPAPPATPGAP
TSPAEHRLLKTCWSC
Storage
-20C
Provider Type Product Number
- No reagents -