HPA014600

MARCH1 antibody from Atlas Antibodies
FLJ20668, MARCH-I, RNF171
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA014600
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA014600, RRID:AB_1234801
Product name
Anti-MARCH1
Provider product page
Atlas Antibodies - HPA014600
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KVYVQLWRRLKAYNRVIFVQNCPDTAKKLEKNFSC
NVNTDIKDAVVVPVPQTGANSLPSAEGG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -