HPA014589

TOMM70A antibody from Atlas Antibodies
KIAA0719
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA014589
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA014589, RRID:AB_1235978
Product name
Anti-TOMM70
Provider product page
Atlas Antibodies - HPA014589
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PLLSTQDFNMAADIDPQNADVYHHRGQLKILLDQV
EEAVADFDECIRLRPESALAQAQKCFALYRQAYTG
NNSSQIQAAMKGFEEVIKKFPRCAEGYALYAQALT
DQQQFGKADEMYDKCIDLEPDNATT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -