HPA011041

CEACAM3 antibody from Sigma-Aldrich
CD66d, CGM1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011041
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011041, RRID:AB_1078481
Product name
Anti-CEACAM3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011041
Antibody type
Polyclonal
Antigen
Carcinoembryonic antigen-related cell adhesion molecule 3 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQE
Storage
-20C
Provider Type Product Number
- No reagents -