HPA021200

AJM1 antibody from Atlas Antibodies
ajm-1, C9orf172
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA021200
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA021200, RRID:AB_10601695
Product name
Anti-C9orf172
Provider product page
Atlas Antibodies - HPA021200
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PRPYPSEELSGPSPRRMGGYYAGEVRTFPIQEPPS
RSYYGEAPRAYGLPYGPRYVPEEPRAHSTARPFYT
EDFGRYRERDVLARTYPHPRSSPAW
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -