HPA021200

C9orf172 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021200
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021200, RRID:AB_10601695
Product name
Anti-C9orf172 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021200
Antibody type
Polyclonal
Antigen
Putative uncharacterized protein ENSP00000412388 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PRPYPSEELSGPSPRRMGGYYAGEVRTFPIQEPPS
RSYYGEAPRAYGLPYGPRYVPEEPRAHSTARPFYT
EDFGRYRERDVLARTYPHPRSSPAW
Storage
-20C
Provider Type Product Number
- No reagents -