HPA005697

LDOC1L antibody from Sigma-Aldrich
dJ1033E15.2, DKFZp761O17121, Mar6, Mart6
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005697
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005697, RRID:AB_1079244
Product name
Anti-LDOC1L antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005697
Antibody type
Polyclonal
Antigen
leucine zipper, down-regulated in cancer 1-like recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SVMAELTLLRTRARIPGALQITPPISSITSNGTRP
MTTPPTSLPEPFSGDPGRLAGFLMQMDRFMIFQAS
RFPGEAERVAFLVSRLTGEAEKWAIPHMQPDSPLR
NNYQGF
Storage
-20C
Provider Type Product Number
- No reagents -