Antibody data

Product number
H00010172-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010172-M01, RRID:AB_1137546
Product name
ZNF256 monoclonal antibody (M01), clone 3H7
Provider product page
Abnova Corporation - H00010172-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant ZNF256.
Antigen sequence
CNECGKFFSQSSSLIRHRRSHTGERPYECSECWKS
FSNHSSLVKHRRVHTGERPYECSECGKSFSQSSNL
TNHQRIHSGERPYECSDCGKFFTFNSNLLKHQNVH
KG
Isotype
IgG
Antibody clone number
3H7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -