HPA014275

MARCH7 antibody from Sigma-Aldrich
AXOT, MARCH-VII, RNF177
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014275
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014275, RRID:AB_10599820
Product name
Anti-MARCH7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014275
Antibody type
Polyclonal
Antigen
membrane-associated ring finger (C3HC4) 7 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ILPGSLFRFAVPPALGSNLTDNVMITVDIIPSGWN
SADGKSDKTKSAPSRDPERLQKIK
Storage
-20C
Provider Type Product Number
- No reagents -