ABIN184147
antibody from antibodies-online
Targeting: SEPTIN4
ARTS, C17orf47, CE5B3, FLJ40121, H5, hCDCREL-2, hucep-7, MART, PNUTL2, SEPT4
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN184147 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Septin 4 (SEPT4) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SEPT4: synthetic peptide directed towards the N terminal of human SEPT4 (septin-4)
- Description
- Affinity Purified
- Reactivity
- Human, Canine
- Host
- Rabbit
- Antigen sequence
RSLGWQGNSVPEDRTEAGIKRFLEDTTDDGELSKF
VKDFS GNASCHPPEA- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Mitochondrial pro-apoptotic ARTS protein is lost in the majority of acute lymphoblastic leukemia patients.
Elhasid R, Sahar D, Merling A, Zivony Y, Rotem A, Ben-Arush M, Izraeli S, Bercovich D, Larisch S
Oncogene 2004 Jul 15;23(32):5468-75
Oncogene 2004 Jul 15;23(32):5468-75
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Immunohistochemistry