HPA001185

CXorf21 antibody from Sigma-Aldrich
FLJ11577
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001185
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001185, RRID:AB_1078591
Product name
Anti-CXorf21 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001185
Antibody type
Polyclonal
Antigen
Uncharacterized protein CXorf21 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EIPLPMEDSISTQPSDFPQKPIQRYSSYWRITSIK
EKSSLQMQNPISNAVLNEYLEQKVVELYKQYIMDT
VFHDSSPTQILASELIMTSVDQISLQVSREKNLET
SKARDIVFSRLLQLMST
Storage
-20C
Provider Type Product Number
- No reagents -