Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183997 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Guanine Nucleotide Binding Protein (G Protein), beta Polypeptide 2-Like 1 (GNB2L1) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GNB2L1 antibody: synthetic peptide directed towards the C terminal of human GNB2L1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Canine, Chicken/Avian, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
LEGKIIVDELKQEVISTSSKAEPPQCTSLAWSADG
QTLFA GYTDNLVRVW- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references RACK1 recruits STAT3 specifically to insulin and insulin-like growth factor 1 receptors for activation, which is important for regulating anchorage-independent growth.
Zhang W, Zong CS, Hermanto U, Lopez-Bergami P, Ronai Z, Wang LH
Molecular and cellular biology 2006 Jan;26(2):413-24
Molecular and cellular biology 2006 Jan;26(2):413-24
No comments: Submit comment
No validations: Submit validation data