Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [6]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AMAb91366 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#AMAb91366, RRID:AB_2716654
- Product name
- Anti-CTGF
- Antibody type
- Monoclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Mouse
- Conjugate
- Unconjugated
- Antigen sequence
LPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGP
ALAAYRLEDTFGPDPTMIRANCLVQTTEWSACSKT
CGMG- Isotype
- IgG
- Antibody clone number
- CL5339
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in human cell line U-251 MG.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of mouse brain shows cytoplasmic immunoreactivity in cortical layer 6b neurons.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of mouse cerebral cortex shows cytoplasmic immunoreactivity in layer 6b neurons.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of rat cerebral cortex shows cytoplasmic immunoreactivity in layer 6b neurons.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of rat cerebral cortex shows cytoplasmic immunoreactivity in neurons in layer 6b.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows cytoplasmic immunoreactivity in layer 6 neurons.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lymph node shows absence of positivity in lymphoid cells as expected (negative control).