HPA005845

ZNF645 antibody from Sigma-Aldrich
CT138, FLJ25735, HAKAIL
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005845
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005845, RRID:AB_1859389
Product name
Anti-ZNF645 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005845
Antibody type
Polyclonal
Antigen
Zinc finger protein 645 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TPNSVRSQVPALTTTYDPSSGYIIVKVPPDMNSPP
LRAPQSQNGNPSASEFASHHYNLNILPQFTENQET
LSPQFTQTDAMDHRRWPAWKRLSPCPPTRSPPPST
LHGRSHHSHQR
Storage
-20C
Provider Type Product Number
- No reagents -