HPA000404

KIAA2022 antibody from Sigma-Aldrich
MRX98, XPN
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000404
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000404, RRID:AB_1079208
Product name
Anti-KIAA2022 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000404
Antibody type
Polyclonal
Antigen
Uncharacterized protein KIAA2022 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FLPTTCSSEMPLSSANVTTNIPVIPGGYLQTLLDA
SDLSNNTSISYFSHHSPEQNEGSLTQTEKSFVPLQ
PTQDCVLTSSSDSELQQSSHNFKMESSNYRNVWPN
KATSGTQEFMAEVSRE
Storage
-20C
Provider Type Product Number
- No reagents -