HPA000168

MUM1L1 antibody from Sigma-Aldrich
FLJ33516
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000168
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000168, RRID:AB_1079431
Product name
Anti-MUM1L1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000168
Antibody type
Polyclonal
Antigen
MUM1-like protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KVALGILNERTNLSQASTSDEEEITMLSQNVPQKQ
SDSPPHKKYRKDEGDLPGCLEERENSACLLASSES
DDSLYDDKSQAPTMVDTIPSEVETKSLQNSSWCET
FPSLSE
Storage
-20C
Provider Type Product Number
- No reagents -