ARP46011_P050
antibody from Aviva Systems Biology
Targeting: GUCY1B1
GC-S-beta-1, GC-SB3, GUC1B3, GUCY1B3
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ARP46011_P050 - Provider product page
- Provider
- Aviva Systems Biology
- Product name
- GUCY1B3 Antibody (ARP46011_P050)
- Antibody type
- Polyclonal
- Antigen
- The immunogen is a synthetic peptide directed towards the following sequence VTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENS
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Horse, Rabbit, Zebrafish
- Host
- Rabbit
- Vial size
- 100 μl
- Concentration
- Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- Storage
- For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
No comments: Submit comment
No validations: Submit validation data