HPA020870

GUCY1B3 antibody from Sigma-Aldrich
GC-S-beta-1, GC-SB3, GUC1B3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020870
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020870, RRID:AB_1850444
Product name
Anti-GUCY1B3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020870
Antibody type
Polyclonal
Antigen
Guanylate cyclase soluble subunit beta-1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRI
IYDDSKTYDLVAAASKVLNLNAGEILQMFGKMFFV
FCQESGYDTILRVLGSNVREFLQNLDALHDHLATI
YPGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIV
IGII
Storage
-20C
Provider Type Product Number
- No reagents -