HPA023646

PROSC antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023646
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023646, RRID:AB_1855741
Product name
Anti-PROSC antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023646
Antibody type
Polyclonal
Antigen
Proline synthetase co-transcribed bacterial homolog protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VPNLFMLETVDSVKLADKVNSSWQRKGSPERLKVM
VQINTSGEESKHGLPPSETIAIVEHINAKCPNLEF
VGLMT
Storage
-20C
Provider Type Product Number
- No reagents -