ABIN630183

antibody from antibodies-online

Targeting: SEPTIN6 KIAA0128, MGC16619, MGC20339, SEP2, SEPT2, SEPT6

Western blot

Antibody data

Submit

Validation data

Product number: ABIN630183 - Provider product page
Provider: antibodies-online
Product name: anti-Septin 6 (SEPT6) (Middle Region) antibody
Antibody type: Polyclonal
Antigen: Septin 6 antibody was raised using the middle region of 40427 corresponding to a region with amino acids CKLEEMGFKDTDPDSKPFSLQETYEAKRNEFLGELQKKEEEMRQMFVQRV
Description: Purified
Reactivity: Human, Mouse, Rat
Host: Rabbit
Epitope: Middle Region
Vial size: 100 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.

SEPTIN6 protein structure - ABIN630183 shown in red.