HPA005665

SEPT6 antibody from Sigma-Aldrich
KIAA0128, MGC16619, MGC20339, SEP2, SEPT2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005665
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005665, RRID:AB_1079910
Product name
Anti-Sept6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005665
Antibody type
Polyclonal
Antigen
Septin-6 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LGKSTLMDTLFNTKFEGEPATHTQPGVQLQSNTYD
LQESNVRLKLTIVSTVGFGDQINKEDSYKPIVEFI
DAQFEAYLQEELKIRRVLHTYHDSRIHVCLYFIAP
TGHSLKSLDLVTMKKLDSKVNIIPIIAKADAISKS
EL
Storage
-20C
Provider Type Product Number
- No reagents -