HPA007420

TEN1 antibody from Sigma-Aldrich
C17orf106, FLJ39785
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007420
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007420, RRID:AB_1078490
Product name
Anti-CDK3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007420
Antibody type
Polyclonal
Antigen
Cell division protein kinase 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PSEDTWPGVTQLPDYKGSFPKWTRKGLEEIVPNLE
PEGRDLLMQLLQYDPSQRITAKTALAHPYFSSPEP
SPAARQYVLQRFRH
Storage
-20C
Provider Type Product Number
- No reagents -