HPA018886

NGFRAP1 antibody from Sigma-Aldrich
Bex, BEX3, DXS6984E, HGR74, NADE
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018886
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018886, RRID:AB_1854453
Product name
Anti-NGFRAP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018886
Antibody type
Polyclonal
Antigen
Protein BEX3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NEEMEQPMQNGEEDRPLGGGEGHQPAGNRRGQARR
LAPNFRWAIPNRQINDGMGGDGDDMEIFMEEMREI
RRKLRELQLRNCLRILMGELSNHHDHHDEF
Storage
-20C
Provider Type Product Number
- No reagents -