HPA022896

AC002316.1 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022896
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022896, RRID:AB_1849476
Product name
Anti-GARNL4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022896
Antibody type
Polyclonal
Antigen
Rap1 GTPase-activating protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EDPENVGTPTSLGSSICEEEEEDNLSPNTFGYKLE
CKGEARAYRRHFLGKDHLNFYCTGSSLGNLILSVK
CEEAEGIEYLRVILRSKLKTVHERIPLAGLSKLPS
VPQIAKAFCDDAVGLRFNPVLYPKASQMIVSYDEH
Storage
-20C
Provider Type Product Number
- No reagents -