HPA003272

ZCCHC16 antibody from Sigma-Aldrich
FLJ46608, Mar4, Mart4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003272
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003272, RRID:AB_2257414
Product name
Anti-ZCCHC16 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003272
Antibody type
Polyclonal
Antigen
Zinc finger CCHC domain-containing protein 16 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QDPATFHLLAQNLICNETNQSGQFEKALADPNQDE
ESVTDMMDNLPDLITQCIQLDKKHSDRPELLQSET
QLPLLASLIQHQALFSPTDPPPKKGPIQLREGQLP
LTPAKRARQQETQLCLYCSQSGHFTRDCLAKRSRA
PATTNNTAH
Storage
-20C
Provider Type Product Number
- No reagents -