Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA019601 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA019601, RRID:AB_1856666
- Product name
- Anti-SELENOM
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
QDIPFYHNLVMKHLPGADPELVLLGRRYEELERIP
LSEMTREEINALVQELGFYRKAAPDAQVPPEYVWA
PAKPPEETSDHA- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Mice lacking selenoprotein P and selenocysteine lyase exhibit severe neurological dysfunction, neurodegeneration, and audiogenic seizures.
Deletion of selenoprotein M leads to obesity without cognitive deficits.
Byrns CN, Pitts MW, Gilman CA, Hashimoto AC, Berry MJ
The Journal of biological chemistry 2014 Apr 4;289(14):9662-74
The Journal of biological chemistry 2014 Apr 4;289(14):9662-74
Deletion of selenoprotein M leads to obesity without cognitive deficits.
Pitts MW, Reeves MA, Hashimoto AC, Ogawa A, Kremer P, Seale LA, Berry MJ
The Journal of biological chemistry 2013 Sep 6;288(36):26121-26134
The Journal of biological chemistry 2013 Sep 6;288(36):26121-26134
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN