HPA024658

KIAA1456 antibody from Sigma-Aldrich
C8orf79, FLJ36980
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024658
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024658, RRID:AB_1845787
Product name
Anti-C8orf79 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024658
Antibody type
Polyclonal
Antigen
Putative methyltransferase KIAA1456 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NPSASKILRRISAVDSTDFNPDDTMSVEDPQTDVL
DSTAFMRYYHVFREGELCSLLKENVSELRILSSGN
DHGNWCIIA
Storage
-20C
Provider Type Product Number
- No reagents -