HPA001113

ICK antibody from Sigma-Aldrich
KIAA0936, LCK2, MGC46090, MRK
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001113
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001113, RRID:AB_1851385
Product name
Anti-ICK antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001113
Antibody type
Polyclonal
Antigen
Serine/threonine-protein kinase ICK recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VGHPLGSTTQNLQDSEKPQKGILEKAGPPPYIKPV
PPAQPPAKPHTRISSRQHQASQPPLHLTYPYKAEV
SRTDHPSHLQEDKPSPLLFPSLHNKHPQSKITAGL
EHKNGEIKPKSRRR
Storage
-20C
Provider Type Product Number
- No reagents -