HPA037819

C10orf10 antibody from Atlas Antibodies
DEPP, FIG, Fseg
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA037819
Provider
Atlas Antibodies
Product name
Anti-C10orf10
Provider product page
Atlas Antibodies - HPA037819
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PSPSLDDYVRSISRLAQPTSVLDKATAQGQPRPPH
RPAQACRKGRPAVSLRDITARFSGQQPTLPMADTV
DP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -