HPA019097

GARS antibody from Sigma-Aldrich
CMT2D, DSMAV, GlyRS, SMAD1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019097
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019097, RRID:AB_1849480
Product name
Anti-GARS antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019097
Antibody type
Polyclonal
Antigen
Glycyl-tRNA synthetase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LPLSQNQEFMPFVKELSEALTRHGVSHKVDDSSGS
IGRRYARTDEIGVAFGVTIDFDTVNKTPHTATLRD
RDSMRQIRAEISELPSIVQDLANGNITWADVEARY
PLFEG
Storage
-20C
Provider Type Product Number
- No reagents -