HPA018453

C21orf59 antibody from Atlas Antibodies
C21orf48, CILD26, FBB18, FLJ20467
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA018453
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA018453, RRID:AB_1668372
Product name
Anti-C21orf59
Provider product page
Atlas Antibodies - HPA018453
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GLNVIKEAEAQLWWAAKELRRTKKLSDYVGKNEKT
KIIAKIQQRGQGAPAREPIISSEEQKQLMLYYHRR
QEELKRLEENDDDAYLNSPWADNTALKR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -