HPA018084

PCNXL3 antibody from Sigma-Aldrich
FLJ22427
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018084
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018084, RRID:AB_1855083
Product name
Anti-PCNXL3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018084
Antibody type
Polyclonal
Antigen
Pecanex-like protein 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LIGDLPQTPPGAVPDPSLASTDSSEPSPLAGDGAP
WSGSSMADTPMSPLLKGSLSQELSKSFLTLTRPDR
ALVRTSSRREQRRGAGGYQPLDRRGSGEPTPQKAG
SSDSCFS
Storage
-20C
Provider Type Product Number
- No reagents -