HPA015315

WHSC1 antibody from Sigma-Aldrich
MMSET, NSD2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015315
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015315, RRID:AB_1858831
Product name
Anti-WHSC1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015315
Antibody type
Polyclonal
Antigen
Probable histone-lysine N-methyltransferase NSD2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QAPTKAEKIKLLKPISGKLRAQWEMGIVQAEEAAS
MSVEERKAKFTFLYVGDQLHLNPQVAKEAGIAAES
LGEMAESSGVSEEAAENPKSVREECIPMKRRRRAK
LCSSA
Storage
-20C
Provider Type Product Number
- No reagents -