HPA001520

ATP5B antibody from Sigma-Aldrich
ATPSB
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001520
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001520, RRID:AB_1078243
Product name
Anti-ATP5B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001520
Antibody type
Polyclonal
Antigen
ATP synthase subunit beta, mitochondrial precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TSPSPKAGAATGRIVAVIGAVVDVQFDEGLPPILN
ALEVQGRETRLVLEVAQHLGESTVRTIAMDGTEGL
VRGQKVLDSGAPIKIPVGPETLGRIMNVIGEPIDE
RGPIKTKQFAPIHAEAPEFMEMSVEQEILVTGIKV
VD
Storage
-20C
Provider Type Product Number
- No reagents -