HPA019937

CCDC155 antibody from Sigma-Aldrich
FLJ32658, KASH5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019937
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019937, RRID:AB_1848877
Product name
Anti-CCDC155 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019937
Antibody type
Polyclonal
Antigen
Coiled-coil domain-containing protein 155 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EENGKLLAERDGVKKRSQELAMEKDTLKRQLFECE
HLICQRDTILSERTRDVESLAQTLEEYRVTTQELR
LEISRLEEQLSQTYEGPDELPEGA
Storage
-20C
Provider Type Product Number
- No reagents -