HPA003322

T antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003322
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003322, RRID:AB_1080176
Product name
Anti-T antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003322
Antibody type
Polyclonal
Antigen
Brachyury protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QQPGYSQWGWLLPGTSTLCPPANPHPQFGGALSLP
STHSCDRYPTLRSHRSSPYPSPYAHRNNSPTYSDN
SPACLSMLQSHDNWSSLGMPAHPSMLPVSHNASPP
TSSSQY
Storage
-20C
Provider Type Product Number
- No reagents -