HPA005659

WHSC1L1 antibody from Sigma-Aldrich
FLJ20353, NSD3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005659
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005659, RRID:AB_1080596
Product name
Anti-WHSC1L1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005659
Antibody type
Polyclonal
Antigen
Histone-lysine N-methyltransferase NSD3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MMRCLRCPVAYHSGDACIAAGSMLVSSYILICSNH
SKRSSNSSAVNVGFCFVCARGLIVQDHSDPMFSSY
AYKSHYLLNESNRAELMKLPMIPSSSASKKKCEKG
GRLLCCESCPASFHPECLSIEMPEGCWNC
Storage
-20C
Provider Type Product Number
- No reagents -