HPA004633

C9orf3 antibody from Sigma-Aldrich
AOPEP, AP-O, APO, C90RF3, FLJ14675
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004633
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004633, RRID:AB_1078362
Product name
Anti-C9orf3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004633
Antibody type
Polyclonal
Antigen
Aminopeptidase O recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ECSSWYYYVTMPMPASTFTIAVGCWTEMKMETWSS
NDLATERPFSPSEANFRHVGVCSHMEYPCRFQNAS
ATTQEIIPHRVFAPVCLTGACQETLLRLIPPCLSA
AHSVLGAHPFSRLDVLIVPANFPSLGMA
Storage
-20C
Provider Type Product Number
- No reagents -