Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN311711 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Arginase, Type II (ARG2) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ARG2 antibody: synthetic peptide directed towards the C terminal of human ARG2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Rabbit
- Host
- Rabbit
- Antigen sequence
SALDLVEVNPQLATSEEEAKTTANLAVDVIASSFG
QTREG GHIVYDQLPT- Vial size
- 50 μg
- Storage
- Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -20°C
Submitted references Nicotinic acid inhibits progression of atherosclerosis in mice through its receptor GPR109A expressed by immune cells.
Expression of arginase II in prostate cancer.
Lukasova M, Malaval C, Gille A, Kero J, Offermanns S
The Journal of clinical investigation 2011 Mar;121(3):1163-73
The Journal of clinical investigation 2011 Mar;121(3):1163-73
Expression of arginase II in prostate cancer.
Mumenthaler SM, Yu H, Tze S, Cederbaum SD, Pegg AE, Seligson DB, Grody WW
International journal of oncology 2008 Feb;32(2):357-65
International journal of oncology 2008 Feb;32(2):357-65
No comments: Submit comment
No validations: Submit validation data