Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA000653 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA000653, RRID:AB_1080551
- Product name
- Anti-VASH1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
GALGMSRREDLMYKPPAFRTLSELVLDFEAAYGRC
WHVLKKVKLGQSVSHDPHSVEQIEWKHSVLDVERL
GRDDFRKELERHARDMRLKIGKGTGPPSPTKDRKK
DVSSPQRAQSSPHRRNSRSERRPSGDKKTSEPKAM
PD- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Systematically generated antibodies against human gene products: high throughput screening on sections from the rat nervous system.
Mulder J, Wernérus H, Shi TJ, Pontén F, Hober S, Uhlén M, Hökfelt T
Neuroscience 2007 Jun 8;146(4):1689-703
Neuroscience 2007 Jun 8;146(4):1689-703
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Recombinant expression validation
- Main image
- Experimental details
- Western blot analysis in control (vector only transfected HEK293T lysate) and VASH1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY414940).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human placenta shows cytoplasmic positivity in trophoblastic cells.
- Sample type
- HUMAN