HPA000653

VASH1 antibody from Sigma-Aldrich
KIAA1036
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000653
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000653, RRID:AB_1080551
Product name
Anti-VASH1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000653
Antibody type
Polyclonal
Antigen
Vasohibin-1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GALGMSRREDLMYKPPAFRTLSELVLDFEAAYGRC
WHVLKKVKLGQSVSHDPHSVEQIEWKHSVLDVERL
GRDDFRKELERHARDMRLKIGKGTGPPSPTKDRKK
DVSSPQRAQSSPHRRNSRSERRPSGDKKTSEPKAM
PD
Storage
-20C
Provider Type Product Number
- No reagents -