Antibody data

Product number
PAB28215
Provider
Abnova Corporation
Product name
C14orf38 polyclonal antibody
Provider product page
Abnova Corporation - PAB28215
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant C14orf38.
Antigen sequence
AGEKLVQAAAVSTGPSLELCTLPSTLGSSVAVEAL
EQLFVVEQSLQSDYFKCNEEAKIFLKDIAVAVKKL
EEMRKATIDLLEIESMELNKLYYLLETLPNSIKRE
LEECVRDARRLNLFEINTIKMRITRTENEIELL
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -