HPA004200

CCDC175 antibody from Sigma-Aldrich
C14orf38
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004200
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004200, RRID:AB_1078743
Product name
Anti-C14orf38 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004200
Antibody type
Polyclonal
Antigen
Putative uncharacterized protein ENST00000281581 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AGEKLVQAAAVSTGPSLELCTLPSTLGSSVAVEAL
EQLFVVEQSLQSDYFKCNEEAKIFLKDIAVAVKKL
EEMRKATIDLLEIESMELNKLYYLLETLPNSIKRE
LEECVRDARRLNLFEINTIKMRITRTENEIELL
Storage
-20C
Provider Type Product Number
- No reagents -