HPA006979

LRRFIP1 antibody from Atlas Antibodies
FLAP-1, FLIIAP1, GCF-2, HUFI-1, TRIP
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA006979
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA006979, RRID:AB_1079282
Product name
Anti-LRRFIP1
Provider product page
Atlas Antibodies - HPA006979
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KTEVPGSPAGTEGNCQEATGPSTVDTQNEPLDMKE
PDEEKSDQQGEALDSSQKKTKNKKKKNKKKKSPVP
VETLKDVKKELTYQNTDLSEIKEEEQVKSTDRKSA
VEAQNEVTENPKQKIAAESSENVDCPENPKIKLDG
KLDQEGDDV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -