HPA006979

LRRFIP1 antibody from Sigma-Aldrich
FLAP-1, FLIIAP1, GCF-2, HUFI-1, TRIP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006979
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006979, RRID:AB_1079282
Product name
Anti-LRRFIP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006979
Antibody type
Polyclonal
Antigen
leucine rich repeat recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KTEVPGSPAGTEGNCQEATGPSTVDTQNEPLDMKE
PDEEKSDQQGEALDSSQKKTKNKKKKNKKKKSPVP
VETLKDVKKELTYQNTDLSEIKEEEQVKSTDRKSA
VEAQNEVTENPKQKIAAESSENVDCPENPKIKLDG
KLDQEGDDV
Storage
-20C
Provider Type Product Number
- No reagents -