HPA026293

CDCA2 antibody from Atlas Antibodies
PPP1R81, Repo-Man
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA026293
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA026293, RRID:AB_1846384
Product name
Anti-CDCA2
Provider product page
Atlas Antibodies - HPA026293
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VLSSKRRRISYQRDSDENLTDAEGKVIGLQIFNID
TDRACAVETSVDLSEISSKLGSTQSGFLVEESLPL
SELTETSNALKVADCVVGKGSS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -